Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: P9WGY7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 1078-1189
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
DKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHEVLRVQGPREVQIHLVRE
VQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAE
Structures of the domain P9WGY7 1078-1189
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kon X-ray 3 D 1095-1216 None


© NPIDB team 2003 - 2021

text