Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: P9WGY7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 1080-1201
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
ISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHEVLRVQGPREVQIHLVREVQ
EVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGE
PA
Structures of the domain P9WGY7 1080-1201
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 D 1095-1216 None
5uhb X-ray 4.29 D 1095-1216 None
5uh8 X-ray 4.18 D 1095-1216 None
5uh5 X-ray 3.75 D 1095-1216 None
6jcy X-ray 3.11 D 1095-1216 None
5uha X-ray 3.91 D 1095-1216 None
6c04 X-ray 3.27 D 1089-1216 None
6eec X-ray 3.55 D 1089-1216 None
6dve X-ray 3.81 D 1095-1216 None
6dv9 X-ray 3.8 D 1095-1216 None
5uh9 X-ray 4.4 D 1095-1216 None
5zx2 X-ray 2.8 D 1095-1216 None
6kop X-ray 3.3 D 1095-1216 None
6m7j X-ray 4.4 D 1089-1216 None
6tye X-ray 3.79 D 1095-1216 None
5uhd X-ray 4.01 D 1095-1216 None
5uh6 X-ray 3.84 D 1095-1216 None
6dvc X-ray 3.3 D 1095-1216 None
5uhe X-ray 4.04 D 1095-1216 None
6bzo X-ray 3.38 D 1090-1216 None
5uhg X-ray 3.97 D 1095-1216 None
5uhc X-ray 3.8 D 1095-1216 None
6ee8 X-ray 3.92 D 1089-1216 None
6dvb X-ray 3.8 D 1095-1216 None
6dvd X-ray 3.9 D 1095-1216 None


© NPIDB team 2003 - 2021

text