Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: P9WGY7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 4-417
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
VNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCG
KYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPK
DLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKAVEDQRDGELEARAQKLEADLAE
LEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENLYRE
LVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQ
QSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAP
EIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKSLSDLLKGKQGRFRQNL
Structures of the domain P9WGY7 4-417
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 D 4-417  H-Bb L-Bb 
6vw0 X-ray 3.59 D 4-417  L-Bb 
5uhb X-ray 4.29 D 4-417  H-Bb 
6vvx X-ray 3.39 D 4-417  H-Bb L-Bb 
5uh8 X-ray 4.18 D 4-417 None
5uh5 X-ray 3.75 D 4-417 None
6jcy X-ray 3.11 D 4-417  H-Bb L-Bb 
5uha X-ray 3.91 D 4-417  H-Bb 
6c04 X-ray 3.27 D 4-417  H-Bb H-Mj 
6koq X-ray 3.35 D 4-417  H-Bb H-Mj L-Bb 
6tyf X-ray 3.8 D 6-417  H-Bb H-Mj L-Bb 
6eec X-ray 3.55 D 4-417  H-Bb L-Bb 
6dve X-ray 3.81 D 4-417  H-Bb H-Mj L-Bb 
6dv9 X-ray 3.8 D 4-417  H-Bb H-Mj L-Bb 
5uh9 X-ray 4.4 D 4-417 None
5zx2 X-ray 2.8 D 4-417  H-Bb H-Mj L-Bb 
6tyg X-ray 3.5 D 6-417  H-Bb H-Mj L-Bb 
6kop X-ray 3.3 D 4-417  H-Bb H-Mj L-Bb 
6m7j X-ray 4.4 D 4-417  L-Bb 
6koo X-ray 2.8 D 4-417  H-Bb L-Bb 
6tye X-ray 3.79 D 6-417  H-Bb H-Mj L-Bb 
5uhd X-ray 4.01 D 4-417  H-Bb L-Bb 
6edt X-ray 0 D 4-417  H-Bb L-Bb 
5uh6 X-ray 3.84 D 4-417 None
6dvc X-ray 3.3 D 4-417  H-Mj 
5uhe X-ray 4.04 D 4-417  H-Bb 
6bzo X-ray 3.38 D 4-417  L-Bb 
5uhg X-ray 3.97 D 4-417  H-Bb 
5uhc X-ray 3.8 D 4-417 None
6kon X-ray 3 D 4-417  H-Bb H-Mj L-Bb 
6ee8 X-ray 3.92 D 4-417  H-Bb L-Bb 
6jcx X-ray 2.9 D 4-417  H-Bb L-Bb 
6dvb X-ray 3.8 D 4-417  H-Bb L-Bb 
6dvd X-ray 3.9 D 4-417  H-Bb L-Bb 
6vvy X-ray 3.42 D 4-417  L-Bb 
6vvz X-ray 3.72 D 4-417  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text