Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.20)
Uniprot AC: P9WGY7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 564-736
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
NILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAAD
RGVLSVRAKIKVRLTQLRPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPF
VNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADV
Structures of the domain P9WGY7 564-736
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 D 564-736 None
6vw0 X-ray 3.59 D 564-736 None
5uhb X-ray 4.29 D 564-736 None
6vvx X-ray 3.39 D 564-736 None
5uh8 X-ray 4.18 D 564-736 None
5uh5 X-ray 3.75 D 564-736 None
6jcy X-ray 3.11 D 564-736 None
5uha X-ray 3.91 D 564-736 None
6c04 X-ray 3.27 D 564-736 None
6koq X-ray 3.35 D 564-736 None
6tyf X-ray 3.8 D 564-736 None
6eec X-ray 3.55 D 564-736 None
6dve X-ray 3.81 D 564-736 None
6dv9 X-ray 3.8 D 564-736 None
5uh9 X-ray 4.4 D 564-736 None
5zx2 X-ray 2.8 D 564-736 None
6tyg X-ray 3.5 D 564-736 None
6kop X-ray 3.3 D 564-736 None
6m7j X-ray 4.4 D 564-736 None
6koo X-ray 2.8 D 564-736 None
6tye X-ray 3.79 D 564-736 None
5uhd X-ray 4.01 D 564-736 None
6edt X-ray 0 D 564-736 None
5uh6 X-ray 3.84 D 564-736 None
6dvc X-ray 3.3 D 564-736 None
5uhe X-ray 4.04 D 564-736 None
6bzo X-ray 3.38 D 564-736 None
5uhg X-ray 3.97 D 564-736 None
5uhc X-ray 3.8 D 564-736 None
6kon X-ray 3 D 564-736 None
6ee8 X-ray 3.92 D 564-736 None
6jcx X-ray 2.9 D 564-736 None
6dvb X-ray 3.8 D 564-736 None
6dvd X-ray 3.9 D 564-736 None
6vvy X-ray 3.42 D 564-736 None
6vvz X-ray 3.72 D 564-736 None


© NPIDB team 2003 - 2021

text