Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: P9WGY7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 842-1010
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb 

Sequence:
EGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCQTERGIVVEL
AERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQVK
VRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQL
Structures of the domain P9WGY7 842-1010
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 D 843-1011  H-Bb 
5uhb X-ray 4.29 D 843-1011  H-Bb 
5uh8 X-ray 4.18 D 843-1011  H-Bb 
5uh5 X-ray 3.75 D 843-1011  H-Bb 
6jcy X-ray 3.11 D 843-1011  H-Bb 
5uha X-ray 3.91 D 843-1011  H-Bb 
6koq X-ray 3.35 D 843-1012  H-Bb 
6dve X-ray 3.81 D 843-1011  H-Bb 
6dv9 X-ray 3.8 D 843-1011  H-Bb 
5uh9 X-ray 4.4 D 843-1011  H-Bb 
5zx2 X-ray 2.8 D 843-1011  H-Bb 
6koo X-ray 2.8 D 843-1025  H-Bb 
6tye X-ray 3.79 D 843-1011  H-Bb 
5uhd X-ray 4.01 D 843-1011  H-Bb 
5uh6 X-ray 3.84 D 843-1011 None
6dvc X-ray 3.3 D 843-1011  H-Bb 
5uhe X-ray 4.04 D 843-1011 None
6bzo X-ray 3.38 D 843-1025 None
5uhg X-ray 3.97 D 843-1011 None
5uhc X-ray 3.8 D 843-1011  H-Bb 
6kon X-ray 3 D 843-1011  H-Bb 
6jcx X-ray 2.9 D 843-1012  H-Bb 
6dvb X-ray 3.8 D 843-1011  H-Bb 
6dvd X-ray 3.9 D 843-1011  H-Bb 


© NPIDB team 2003 - 2021

text