Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: P9WGY7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 846-1017
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
VLEYFINTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCQTERGIVVELAERA
PDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQVKVRSV
LTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQ
Structures of the domain P9WGY7 846-1017
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6c04 X-ray 3.27 D 843-1025 None
6eec X-ray 3.55 D 843-1025 None
6kop X-ray 3.3 D 843-1012  H-Bb 
6m7j X-ray 4.4 D 843-1025 None
6ee8 X-ray 3.92 D 843-1025 None


© NPIDB team 2003 - 2021

text