Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.17)
Uniprot AC: P9WGY9
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 52-425
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
GLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMSLSFSDPR
FDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIINGT
ERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRR
QPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKES
AQTLLENLFFKEKRYDLARVGRYKVNKKLGLHVGEPITSSTLTEEDVVATIEYLVRLHEG
QTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTTQDVEA
ITPQTLINIRPVVA
Structures of the domain P9WGY9 52-425
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 C 105-423 None
6vw0 X-ray 3.59 C 105-423  L-Bb 
5uhb X-ray 4.29 C 105-423 None
6vvx X-ray 3.39 C 105-423  L-Bb 
5uh8 X-ray 4.18 C 105-423 None
5uh5 X-ray 3.75 C 105-423 None
6jcy X-ray 3.11 C 105-423 None
5uha X-ray 3.91 C 105-423 None
6c04 X-ray 3.27 C 105-423  L-Bb 
6koq X-ray 3.35 C 99-417 None
6tyf X-ray 3.8 C 105-423  L-Bb 
6eec X-ray 3.55 C 105-423  L-Bb 
6dve X-ray 3.81 C 105-423  L-Bb 
6dv9 X-ray 3.8 C 105-423  L-Bb 
5uh9 X-ray 4.4 C 105-423 None
5zx2 X-ray 2.8 C 105-423 None
6tyg X-ray 3.5 C 105-423  L-Bb 
6kop X-ray 3.3 C 99-417 None
6m7j X-ray 4.4 C 105-423 None
6koo X-ray 2.8 C 99-417 None
6tye X-ray 3.79 C 105-423  L-Bb 
5uhd X-ray 4.01 C 105-423  L-Bb 
6edt X-ray 0 C 105-423  L-Bb 
5uh6 X-ray 3.84 C 105-423 None
6dvc X-ray 3.3 C 105-423 None
5uhe X-ray 4.04 C 105-423 None
6bzo X-ray 3.38 C 105-423 None
5uhg X-ray 3.97 C 105-423 None
5uhc X-ray 3.8 C 105-423 None
6kon X-ray 3 C 99-417  L-Bb 
6ee8 X-ray 3.92 C 105-423  L-Bb 
6jcx X-ray 2.9 C 104-423 None
6dvb X-ray 3.8 C 105-423  L-Bb 
6dvd X-ray 3.9 C 105-423  L-Bb 
6vvy X-ray 3.42 C 105-423  L-Bb 
6vvz X-ray 3.72 C 105-423  L-Bb 


© NPIDB team 2003 - 2021

text