Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: P9WGZ1
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 52-152
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
TSIRIDGVLHEFTTVPGVKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQGPGEVTAGDIV
PPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQN
Structures of the domain P9WGZ1 52-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 A 52-152 None
5uhf X-ray 4.35 B 52-152 None
6vw0 X-ray 3.59 A 52-152 None
6vw0 X-ray 3.59 B 52-152 None
5uhb X-ray 4.29 B 52-152 None
5uhb X-ray 4.29 A 52-152 None
6vvx X-ray 3.39 B 52-152 None
6vvx X-ray 3.39 A 52-152 None
5uh8 X-ray 4.18 B 52-152 None
5uh8 X-ray 4.18 A 52-152 None
5uh5 X-ray 3.75 A 52-152 None
5uh5 X-ray 3.75 B 52-152 None
6jcy X-ray 3.11 A 52-152 None
6jcy X-ray 3.11 B 52-169 None
5uha X-ray 3.91 B 52-152 None
5uha X-ray 3.91 A 52-152 None
6c04 X-ray 3.27 B 52-152 None
6c04 X-ray 3.27 A 52-152 None
6koq X-ray 3.35 B 52-177 None
6koq X-ray 3.35 A 52-152 None
6tyf X-ray 3.8 A 52-152 None
6tyf X-ray 3.8 B 52-152 None
6eec X-ray 3.55 B 52-152 None
6eec X-ray 3.55 A 52-152 None
6dve X-ray 3.81 B 52-152 None
6dve X-ray 3.81 A 52-152 None
6dv9 X-ray 3.8 B 52-152 None
6dv9 X-ray 3.8 A 52-152 None
5uh9 X-ray 4.4 B 52-152 None
5uh9 X-ray 4.4 A 52-152 None
5zx2 X-ray 2.8 B 52-152 None
5zx2 X-ray 2.8 A 52-152 None
6tyg X-ray 3.5 B 52-152 None
6tyg X-ray 3.5 A 52-152 None
6kop X-ray 3.3 B 52-169 None
6kop X-ray 3.3 A 52-152 None
6koo X-ray 2.8 A 52-152 None
6koo X-ray 2.8 B 52-169 None
6tye X-ray 3.79 B 52-152 None
6tye X-ray 3.79 A 52-152 None
5uhd X-ray 4.01 B 52-152 None
5uhd X-ray 4.01 A 52-152 None
6edt X-ray 0 B 52-152 None
6edt X-ray 0 A 52-152 None
5uh6 X-ray 3.84 B 52-152 None
5uh6 X-ray 3.84 A 52-152 None
6dvc X-ray 3.3 B 52-152 None
6dvc X-ray 3.3 A 52-152 None
5uhe X-ray 4.04 B 52-152 None
5uhe X-ray 4.04 A 52-152 None
6bzo X-ray 3.38 B 52-152 None
6bzo X-ray 3.38 A 52-152 None
5uhg X-ray 3.97 B 52-152 None
5uhg X-ray 3.97 A 52-152 None
5uhc X-ray 3.8 B 52-152 None
5uhc X-ray 3.8 A 52-152 None
6kon X-ray 3 B 52-155 None
6kon X-ray 3 A 52-152 None
6ee8 X-ray 3.92 B 52-152 None
6ee8 X-ray 3.92 A 52-152 None
6jcx X-ray 2.9 B 52-169 None
6jcx X-ray 2.9 A 52-152 None
6dvb X-ray 3.8 A 52-152 None
6dvb X-ray 3.8 B 52-152 None
6dvd X-ray 3.9 B 52-152 None
6dvd X-ray 3.9 A 52-152 None
6vvy X-ray 3.42 A 52-152 None
6vvy X-ray 3.42 B 52-152 None
6vvz X-ray 3.72 A 52-152 None
6vvz X-ray 3.72 B 52-152 None


© NPIDB team 2003 - 2021

text