Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: P9WJB7
RecName: Nucleoid-associated protein EspR
Begin-End: 33-76
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
LKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFT
Structures of the domain P9WJB7 33-76
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3qyx X-ray 3.75 C 33-76 None
3qyx X-ray 3.75 B 33-76 None
3qyx X-ray 3.75 D 33-76 None
3qyx X-ray 3.75 A 33-76 None


© NPIDB team 2003 - 2021

text