Pfam domain
Pfam family: Fe_dep_repress (PF01325.21)
Uniprot AC: P9WMH1
RecName: Iron-dependent repressor IdeR
Begin-End: 3-62
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
ELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHL
Structures of the domain P9WMH1 3-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2isz X-ray 2.4 A 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
2isz X-ray 2.4 D 3-62  H-Bb H-Mj L-Bb L-Mj 
2isz X-ray 2.4 C 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
2isz X-ray 2.4 B 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
2it0 X-ray 2.6 D 3-62  H-Bb H-Mj L-Bb L-Mj 
2it0 X-ray 2.6 A 3-62  H-Bb H-Mj L-Bb L-Mj 
2it0 X-ray 2.6 C 3-62  H-Bb H-Mj L-Bb L-Mj L-Mn 
2it0 X-ray 2.6 B 3-62  H-Bb H-Mj L-Bb L-Mj 
1u8r X-ray 2.75 J 3-62  H-Bb H-Mj L-Bb L-Mj 
1u8r X-ray 2.75 G 3-62  H-Bb H-Mj L-Bb L-Mj 
1u8r X-ray 2.75 I 3-62  H-Bb H-Mj L-Bb L-Mj 
1u8r X-ray 2.75 H 3-62  H-Bb H-Mj L-Bb L-Mj 
1u8r X-ray 2.75 D 3-62  H-Bb H-Mj L-Bb L-Mj 
1u8r X-ray 2.75 C 3-62  H-Bb H-Mj L-Bb L-Mj 
1u8r X-ray 2.75 B 3-62  H-Bb H-Mj L-Bb L-Mj 
1u8r X-ray 2.75 A 3-62  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text