Pfam domain
Pfam family: Fe_dep_repr_C (PF02742.17)
Uniprot AC: P9WMH1
RecName: Iron-dependent repressor IdeR
Begin-End: 65-134
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
TEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPT
TSPFGNPIPG
Structures of the domain P9WMH1 65-134
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2isz X-ray 2.4 A 65-134 None
2isz X-ray 2.4 D 65-134 None
2isz X-ray 2.4 C 65-134 None
2isz X-ray 2.4 B 65-134 None
2it0 X-ray 2.6 D 65-134 None
2it0 X-ray 2.6 C 65-134 None
2it0 X-ray 2.6 B 65-134 None
2it0 X-ray 2.6 A 65-134 None
1u8r X-ray 2.75 J 65-134 None
1u8r X-ray 2.75 I 65-134 None
1u8r X-ray 2.75 H 65-134 None
1u8r X-ray 2.75 G 65-134 None
1u8r X-ray 2.75 D 65-134 None
1u8r X-ray 2.75 C 65-134 None
1u8r X-ray 2.75 B 65-134 None
1u8r X-ray 2.75 A 65-134 None


© NPIDB team 2003 - 2021

text