Pfam domain
Pfam family: cNMP_binding (PF00027.31)
Uniprot AC: P9WMH3
RecName: CRP-like cAMP-activated global transcriptional regulator
Begin-End: 28-116
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
PVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPG
PRTSSATTITEVRAVSMDRDALRSWIADR
Structures of the domain P9WMH3 28-116
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mzh X-ray 2.9 B 28-116  L-Bb 
3mzh X-ray 2.9 A 28-116 None


© NPIDB team 2003 - 2021

text