Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: Q00059
RecName: Transcription factor A, mitochondrial
Begin-End: 50-118
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQV
YKEEISRFK
Structures of the domain Q00059 50-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3tmm X-ray 2.5 A 8-76  H-Bb H-Mj H-Mn L-Bb 
6erp X-ray 4.5 G 50-118  H-Bb H-Mn L-Bb L-Mj L-Mn 
6erp X-ray 4.5 C 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nod X-ray 2.9 H 50-118  H-Bb H-Mj H-Mn L-Bb 
4nod X-ray 2.9 A 50-118  H-Bb H-Mj H-Mn L-Bb 
4nod X-ray 2.9 B 50-118  H-Bb H-Mj H-Mn L-Bb 
4nod X-ray 2.9 G 50-118  H-Bb H-Mj H-Mn L-Bb 
3tq6 X-ray 2.45 A 50-118  H-Bb H-Mj H-Mn L-Bb 
3tq6 X-ray 2.45 B 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nnu X-ray 2.81 B 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nnu X-ray 2.81 A 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nnu X-ray 2.81 B 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nnu X-ray 2.81 A 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
6erq X-ray 4.5 G 50-118  H-Bb H-Mn L-Bb L-Mj L-Mn 
6erq X-ray 4.5 C 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hb4 X-ray 3.05 A 50-118  H-Bb H-Mj H-Mn L-Bb 
6hb4 X-ray 3.05 J 50-118  H-Bb H-Mj H-Mn L-Bb 
6hb4 X-ray 3.05 G 50-118  H-Bb H-Mj H-Mn L-Bb 
6hb4 X-ray 3.05 D 50-118  H-Bb H-Mj H-Mn L-Bb 
6hc3 X-ray 3.1 A 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hc3 X-ray 3.1 D 50-118  H-Bb H-Mj H-Mn L-Bb 
6hc3 X-ray 3.1 G 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hc3 X-ray 3.1 J 50-118  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text