Pfam domain
Pfam family: ResIII (PF04851.17)
Uniprot AC: Q00578
RecName: General transcription and DNA repair factor IIH helicase subunit XPB
Begin-End: 359-519
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
STQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVM
QWRQQFLQWCTLQPENCAVFTSDNKEMFQTESGLVVSTYSMVANTRNRSHDSQKVMDFLT
GREWGFIILDEVHVVPAAMFRRVVSTIAAHAKLGLTATLVR
Structures of the domain Q00578 359-519
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 1 359-519 None
5oqj X-ray 4.7 7 363-519  L-Bb 
5oqm X-ray 5.8 7 363-519 None
6gym X-ray 6.7 7 363-519  H-Bb L-Bb 
5sva X-ray 15.3 Z 359-519  H-Bb 


© NPIDB team 2003 - 2021

text