Pfam domain
Pfam family: ERCC3_RAD25_C (PF16203.7)
Uniprot AC: Q00578
RecName: General transcription and DNA repair factor IIH helicase subunit XPB
Begin-End: 543-770
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LSQKGHIANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRG
DKIIVFSDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSI
DLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSTKR
QAFLVDQGYAFKVITHLHGMENIPNLAYASPRERRELLQEVLLKNEEA
Structures of the domain Q00578 543-770
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 7 543-770  H-Bb 
5oqm X-ray 5.8 7 543-770 None
6gym X-ray 6.7 7 543-770  L-Bb 


© NPIDB team 2003 - 2021

text