Pfam domain
Pfam family: ERCC3_RAD25_C (PF16203.7)
Uniprot AC: Q00578
RecName: General transcription and DNA repair factor IIH helicase subunit XPB
Begin-End: 549-785
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRGDKIIVF
SDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSIDLPEAT
CLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVD
QGYAFKVITHLHGMENIPNLAYASPRERRELLQEVLLKNEEAAGIEVGDDADNSVGR
Structures of the domain Q00578 549-785
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 1 535-784  L-Bb 
5sva X-ray 15.3 Z 535-784 None


© NPIDB team 2003 - 2021

text