Pfam domain
Pfam family: RHD_dimer (PF16179.7)
Uniprot AC: Q00653
RecName: Nuclear factor NF-kappa-B p100 subunit
Begin-End: 229-327
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb 

Sequence:
KISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIV
FRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYP
Structures of the domain Q00653 229-327
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1a3q X-ray 2.1 B 229-327  S-Bb L-Bb 
1a3q X-ray 2.1 A 229-327  L-Bb 
3do7 X-ray 3.05 B 229-329  L-Bb 
5zmc X-ray 2.99 A 229-328 None


© NPIDB team 2003 - 2021

text