Pfam domain
Pfam family: RNA_pol_I_A49 (PF06870.14)
Uniprot AC: Q01080
RecName: DNA-directed RNA polymerase I subunit RPA49
Begin-End: 33-110
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGLFNPEKKSIQLYK
APVLVSKVVSKSSKNLRG
Structures of the domain Q01080 33-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m5x X-ray 4 M 33-110 None
5m5y X-ray 4 M 33-110 None


© NPIDB team 2003 - 2021

text