Pfam domain
Pfam family: RNA_pol_I_A49 (PF06870.14)
Uniprot AC: Q01080
RecName: DNA-directed RNA polymerase I subunit RPA49
Begin-End: 33-403
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGLFNPEKKSIQLYK
APVLVSKVVSKSSKNLRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSD
KLTDSAIDIVDSVRTASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESIIPKKE
LQFIRVSSILKEADKEKKLELFPYQNNSKYVAKKLDSLTQPSQMTKLQLLYYLSLLLGVY
ENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKPGQFGRSKDRSYFIDPQNEDKILCYI
LAIIMHLDNFIVEITPLAHELNLKPSKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASY
KIATMKVPFKL
Structures of the domain Q01080 33-403
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m64 X-ray 4.6 M 183-403 None
5w66 X-ray 3.9 M 33-403  H-Bb 
6rqt X-ray 4 M 33-403 None
6h68 X-ray 4.6 M 33-403  H-Bb 
6rwe X-ray 3 M 33-401  H-Bb S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text