Pfam domain
Pfam family: Pou (PF00157.19)
Uniprot AC: Q01860
RecName: POU domain, class 5, transcription factor 1
Begin-End: 141-210
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKL
RPLLQKWVEE
Structures of the domain Q01860 141-210
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6yov X-ray 3.42 K 141-208 None
6t90 X-ray 3.05 K 141-210  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text