Pfam domain
Pfam family: SRF-TF (PF00319.20)
Uniprot AC: Q02078
RecName: Myocyte-specific enhancer factor 2A
Begin-End: 10-57
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
RIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQY
Structures of the domain Q02078 10-57
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1c7u NMR B 109-156  H-Bb H-Mj 
1c7u NMR A 9-56  H-Bb H-Mj 
6bz1 X-ray 2.97 C 10-57  H-Bb H-Mj 
6bz1 X-ray 2.97 D 10-57  H-Bb H-Mj 
6bz1 X-ray 2.97 B 10-57  H-Bb H-Mj 
6bz1 X-ray 2.97 A 10-57  H-Bb 
6wc2 X-ray 2.1 A 10-57  L-Bb 
6wc2 X-ray 2.1 B 10-57  H-Bb 
6wc2 X-ray 2.1 C 10-57  H-Bb H-Mj 
6wc2 X-ray 2.1 D 10-57  H-Bb H-Mj 
6wc2 X-ray 2.1 I 10-57  H-Bb L-Bb 
6wc2 X-ray 2.1 J 10-57  H-Bb H-Mj 
3mu6 X-ray 2.43 D 10-57  H-Bb 
3mu6 X-ray 2.43 C 10-57  H-Bb 
3mu6 X-ray 2.43 B 10-57  H-Bb 
3mu6 X-ray 2.43 A 10-57  H-Bb 
1egw X-ray 1.5 B 10-57  H-Bb H-Mj 
1egw X-ray 1.5 A 10-57  H-Bb H-Mj 
1egw X-ray 1.5 D 10-57  H-Bb H-Mj 
1egw X-ray 1.5 C 10-57  H-Bb H-Mj 
3kov X-ray 2.9 J 10-57 None
3kov X-ray 2.9 I 10-57 None
3kov X-ray 2.9 B 10-57 None
3kov X-ray 2.9 A 10-57 None
6byy X-ray 2.3 B 10-57  H-Bb 
6byy X-ray 2.3 A 10-57  H-Bb 
6byy X-ray 2.3 D 10-57 None
6byy X-ray 2.3 C 10-57  H-Bb 
3p57 X-ray 2.19 A 10-57  H-Bb H-Mj 
3p57 X-ray 2.19 B 10-57  H-Bb H-Mj 
3p57 X-ray 2.19 C 10-57  H-Bb 
3p57 X-ray 2.19 D 10-57  H-Bb 
3p57 X-ray 2.19 I 10-57  H-Bb H-Mj 
3p57 X-ray 2.19 J 10-57  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text