Pfam domain
Pfam family: PAX (PF00292.20)
Uniprot AC: Q02548
RecName: Paired box protein Pax-5
Begin-End: 19-140
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
GVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSI
KPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRI
IR
Structures of the domain Q02548 19-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1k78 X-ray 2.25 A 19-140  H-Bb H-Mj L-Bb L-Mj L-Mn 
1k78 X-ray 2.25 E 19-140  H-Bb H-Mj L-Bb L-Mj L-Mn 
1mdm X-ray 2.8 A 19-140  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text