Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: Q02880
RecName: DNA topoisomerase 2-beta
Begin-End: 477-592
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mn 

Sequence:
TLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVG
LQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLE
Structures of the domain Q02880 477-592
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4g0u X-ray 2.7 A 472-589  H-Bb S-Bb L-Bb L-Mn 
4g0u X-ray 2.7 B 472-588  H-Bb S-Bb L-Bb L-Mn 
5zen X-ray 2.75 A 472-587  H-Bb S-Bb L-Bb L-Mn 
3qx3 X-ray 2.16 B 472-587  H-Bb H-Mn S-Bb L-Bb L-Mn 
3qx3 X-ray 2.16 A 472-588  H-Bb H-Mn S-Bb L-Bb L-Mn 
4j3n X-ray 2.3 A 472-588  H-Bb S-Bb L-Bb L-Mn 
4j3n X-ray 2.3 B 472-587  H-Bb S-Bb L-Bb L-Mn 
4g0w X-ray 2.7 B 472-588  H-Bb S-Bb L-Bb L-Mn 
4g0w X-ray 2.7 A 472-588  H-Bb S-Bb L-Bb L-Mn 
4g0v X-ray 2.55 B 472-588  H-Bb S-Bb L-Bb L-Mn 
4g0v X-ray 2.55 A 472-648  H-Bb S-Bb L-Bb L-Mn 
5gwi X-ray 2.74 A 472-588  H-Bb S-Bb L-Bb L-Mn 
5gwi X-ray 2.74 B 472-587  H-Bb S-Bb L-Bb L-Mn 
5gwj X-ray 2.57 A 472-587  H-Bb S-Bb L-Bb L-Mn 
5gwj X-ray 2.57 B 472-587  H-Bb S-Bb L-Bb L-Mn 
5zrf X-ray 2.3 B 472-587  H-Bb H-Mn S-Bb L-Bb L-Mn 
5zrf X-ray 2.3 A 472-588  H-Bb H-Mn S-Bb L-Bb L-Mn 
5zqf X-ray 3.87 A 472-587  H-Bb S-Bb L-Bb L-Mn 
5zad X-ray 2.54 B 472-588  H-Bb S-Bb L-Bb L-Mn 
5zad X-ray 2.54 A 472-588  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text