Pfam domain
Pfam family: TOPRIM_C (PF16898.7)
Uniprot AC: Q02880
RecName: DNA topoisomerase 2-beta
Begin-End: 594-732
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn L-Bb L-Mj 

Sequence:
FITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADME
RHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKH
LTYNDFINKELILFSNSDN
Structures of the domain Q02880 594-732
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4g0u X-ray 2.7 B 586-727  H-Bb L-Bb 
4g0u X-ray 2.7 A 585-727  H-Bb L-Bb 
5zen X-ray 2.75 A 589-727  H-Bb 
3qx3 X-ray 2.16 B 589-727  H-Bb L-Bb 
3qx3 X-ray 2.16 A 581-727  H-Bb H-Mn L-Bb 
4j3n X-ray 2.3 B 589-727  H-Bb 
4j3n X-ray 2.3 A 586-727  H-Bb 
4g0w X-ray 2.7 B 582-727  H-Bb L-Bb L-Mj 
4g0w X-ray 2.7 A 586-727  H-Bb H-Mn 
4g0v X-ray 2.55 B 582-727  H-Bb 
4g0v X-ray 2.55 A 582-727  H-Bb 
5gwi X-ray 2.74 A 581-727  H-Bb 
5gwi X-ray 2.74 B 589-727  H-Bb 
5gwj X-ray 2.57 B 589-727  H-Bb 
5gwj X-ray 2.57 A 592-727  H-Bb 
5zrf X-ray 2.3 B 589-727  H-Bb 
5zrf X-ray 2.3 A 581-727  H-Bb 
5zqf X-ray 3.87 A 589-727  H-Bb 
5zad X-ray 2.54 B 589-727  H-Bb 
5zad X-ray 2.54 A 589-727  H-Bb 


© NPIDB team 2003 - 2021

text