Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: Q02880
RecName: DNA topoisomerase 2-beta
Begin-End: 734-1190
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb L-Mn 

Sequence:
RSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLA
QNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDD
NQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNY
KNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPA
LISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKY
ETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKD
LIQMLVQRGYESDPVKAWKEAQEKAAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWS
LTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLA
Structures of the domain Q02880 734-1190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4g0u X-ray 2.7 B 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
4g0u X-ray 2.7 A 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
5zen X-ray 2.75 A 729-1185  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
3qx3 X-ray 2.16 B 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
3qx3 X-ray 2.16 A 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
4j3n X-ray 2.3 B 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
4j3n X-ray 2.3 A 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
4g0w X-ray 2.7 B 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
4g0w X-ray 2.7 A 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
4g0v X-ray 2.55 B 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
4g0v X-ray 2.55 A 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb L-Mn 
5gwi X-ray 2.74 B 729-1185  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5gwi X-ray 2.74 A 729-1185  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5gwj X-ray 2.57 B 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
5gwj X-ray 2.57 A 729-1185  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5zrf X-ray 2.3 A 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
5zrf X-ray 2.3 B 729-1185  H-Bb H-Mj H-Mn S-Bb S-Mj S-Mn L-Bb 
5zqf X-ray 3.87 A 729-1185  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5zad X-ray 2.54 B 729-1185  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5zad X-ray 2.54 A 729-1185  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 


© NPIDB team 2003 - 2021

text