Pfam domain
Pfam family: Tfb2_C (PF18307.3)
Uniprot AC: Q02939
RecName: General transcription and DNA repair factor IIH subunit TFB2
Begin-End: 439-506
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGN
SQVLDFAK
Structures of the domain Q02939 439-506
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 2 439-506 None
5oqm X-ray 5.8 2 439-506 None
6gym X-ray 6.7 2 439-506 None


© NPIDB team 2003 - 2021

text