Pfam domain
Pfam family: Tfb2_C (PF18307.3)
Uniprot AC: Q02939
RecName: General transcription and DNA repair factor IIH subunit TFB2
Begin-End: 447-506
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAK
Structures of the domain Q02939 447-506
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 W 447-506 None
5sva X-ray 15.3 a 3-62 None


© NPIDB team 2003 - 2021

text