Pfam domain
Pfam family: Fapy_DNA_glyco (PF01149.26)
Uniprot AC: Q031W6
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 2-115
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:  L-Bb L-Mj L-Mn 

Sequence:
PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKIIQGILRRGKYLI
FEIGDDFRLISHLRMEGKYRLATLDAPREKHDHLTMKFSDGQLIYADVRKFGTW
Structures of the domain Q031W6 2-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4cis X-ray 2.05 B 1-114  L-Bb L-Mj L-Mn 
4cis X-ray 2.05 A 1-114  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text