Pfam domain
Pfam family: zf-C3HC4_5 (PF17121.7)
Uniprot AC: Q03290
RecName: RNA polymerase II transcription factor B subunit 3
Begin-End: 10-60
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKGCD
Structures of the domain Q03290 10-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 3 10-60 None
5oqm X-ray 5.8 3 10-60 None
6gym X-ray 6.7 3 10-60 None


© NPIDB team 2003 - 2021

text