Pfam domain
Pfam family: MAT1 (PF06391.15)
Uniprot AC: Q03290
RecName: RNA polymerase II transcription factor B subunit 3
Begin-End: 63-145
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNKYLEEVEDIIYKLDH
GIDVAKTEEKLRTYEELNKQLIM
Structures of the domain Q03290 63-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 3 63-145 None
5oqm X-ray 5.8 3 63-145 None
6gym X-ray 6.7 3 63-145 None


© NPIDB team 2003 - 2021

text