Pfam domain
Pfam family: Dpy-30 (PF05186.15)
Uniprot AC: Q03323
RecName: COMPASS component SDC1
Begin-End: 127-161
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQS
Structures of the domain Q03323 127-161
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ven X-ray 3.37 Q 127-161 None


© NPIDB team 2003 - 2021

text