Pfam domain
Pfam family: SLD5_C (PF16922.7)
Uniprot AC: Q03406
RecName: DNA replication complex GINS protein SLD5
Begin-End: 222-293
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PDWNKFVFIHVNGPPDGKWNEDPLLQENEFGKPCYTVTIPDLKEEVELTIGSIYVMRYEV
IRDLLRDDKVAL
Structures of the domain Q03406 222-293
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u8t X-ray 4.9 D 222-293 None
5u8s X-ray 6.1 D 222-293 None
6u0m X-ray 3.9 D 222-293 None
6hv9 X-ray 4.98 F 222-293 None


© NPIDB team 2003 - 2021

text