Pfam domain
Pfam family: Sld5 (PF05916.13)
Uniprot AC: Q03406
RecName: DNA replication complex GINS protein SLD5
Begin-End: 74-180
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNASNANPPMPNESKLPLLCMETEL
ERLKFVIRSYIRCRLSKIDKFSLYLRQLNEDENSLISLTDLLSKDEI
Structures of the domain Q03406 74-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u8t X-ray 4.9 D 68-180 None
5u8s X-ray 6.1 D 68-180 None
6u0m X-ray 3.9 D 68-180 None
6hv9 X-ray 4.98 F 61-181 None


© NPIDB team 2003 - 2021

text