Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: Q03654
RecName: Pre-mRNA-splicing factor CEF1
Begin-End: 3-63
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PVPIYVKGGVWTNVEDQILKAAVQKYGTHQWSKVASLLQKKTARQSELRWNEYLNPKLNF
T
Structures of the domain Q03654 3-63
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lj3 X-ray 3.8 O 13-73 None
5lj5 X-ray 3.8 O 13-73 None
5lqw X-ray 5.8 W 13-73 None


© NPIDB team 2003 - 2021

text