Pfam domain
Pfam family: CRISPR_Cas9_WED (PF18061.3)
Uniprot AC: Q03LF7
RecName: CRISPR-associated endonuclease Cas9 1
Begin-End: 820-960
Organism: Streptococcus thermophilus
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
RKISDATIYATRQAKVGKDKADETYVLGKIKDIYTQDGYDAFMKIYKKDKSKFLMYRHDP
QTFEKVIEPILENYPNKQINEKGKEVPCNPFLKYKEEHGYIRKYSKKGNGPEIKSLKYYD
SKLGNHIDITPKDSNNKVVLQ
Structures of the domain Q03LF7 820-960
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rjd X-ray 3.3 C 820-960  S-Bb L-Bb 
6rjg X-ray 3.2 C 820-960  H-Bb S-Bb L-Bb 
6m0x X-ray 2.56 A 820-960  H-Bb S-Bb L-Bb 
6m0v X-ray 3 A 820-960  S-Bb L-Bb 
6m0w X-ray 2.76 A 820-960  S-Bb L-Bb 
6rja X-ray 3 F 820-960 None
6rja X-ray 3 C 820-960 None
6rj9 X-ray 3.2 C 820-960 None


© NPIDB team 2003 - 2021

text