Pfam domain
Pfam family: IMS_C (PF11799.10)
Uniprot AC: Q04049
RecName: DNA polymerase eta
Begin-End: 392-509
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb 

Sequence:
VKSMMSNKNLRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTKS
YEVYRKSGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNFDII
Structures of the domain Q04049 392-509
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2r8k X-ray 3.3 B 392-508  H-Bb S-Bb S-Mj 
2r8k X-ray 3.3 A 392-508  S-Bb S-Mj L-Bb 
3oha X-ray 2 A 392-511  H-Bb S-Bb S-Mj L-Bb 
3mfi X-ray 1.76 A 392-510  H-Bb S-Bb S-Mj L-Bb 
2r8j X-ray 3.1 B 392-508  H-Bb S-Bb S-Mj 
2r8j X-ray 3.1 A 392-508  H-Bb S-Bb 
2wtf X-ray 2.5 B 392-508  H-Bb S-Bb S-Mj L-Bb 
2wtf X-ray 2.5 A 392-508  H-Bb S-Bb S-Mj L-Bb 
2xgq X-ray 2.7 A 392-508  S-Bb S-Mj L-Bb 
2xgq X-ray 2.7 B 392-508  H-Bb S-Bb L-Bb 
3mfh X-ray 2 A 392-511  H-Bb S-Bb S-Mj L-Bb 
3ohb X-ray 2 A 392-511  H-Bb S-Bb S-Mj L-Bb 
2xgp X-ray 2.7 B 392-508  H-Bb S-Bb L-Bb 
2xgp X-ray 2.7 A 392-508  S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text