Pfam domain
Pfam family: RHD_dimer (PF16179.7)
Uniprot AC: Q04206
RecName: Transcription factor p65
Begin-End: 195-291
Organism: Homo sapiens
Interaction Mode:  L-Bb 

Sequence:
KICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRT
PPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
Structures of the domain Q04206 195-291
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2o61 X-ray 2.8 A 195-1008  L-Bb 
3gut X-ray 3.59 G 195-291  L-Bb 
3gut X-ray 3.59 E 195-291 None
3gut X-ray 3.59 C 195-291  L-Bb 
3gut X-ray 3.59 A 195-291 None


© NPIDB team 2003 - 2021

text