Pfam domain
Pfam family: RNA_POL_M_15KD (PF02150.18)
Uniprot AC: Q04307
RecName: DNA-directed RNA polymerase III subunit RPC10
Begin-End: 2-38
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGI
Structures of the domain Q04307 2-38
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 I 2-38 None
5fj8 X-ray 3.9 I 2-38 None
6cnc X-ray 4.1 I 2-38 None
6f44 X-ray 4.2 I 2-34 None
6f41 X-ray 4.3 I 2-34 None
6cnf X-ray 4.5 I 2-38 None
6eu1 X-ray 3.4 I 2-38 None
6f40 X-ray 3.7 I 2-34 None
6cnb X-ray 4.1 I 2-38 None
6f42 X-ray 5.5 I 2-34 None
6cnd X-ray 4.8 I 2-38 None


© NPIDB team 2003 - 2021

text