Pfam domain
Pfam family: Ku (PF02735.18)
Uniprot AC: Q04437
RecName: ATP-dependent DNA helicase II subunit 2
Begin-End: 236-472
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DENCLCIKVEAFPATKAVSGLNRKTAVEVEDSQKKERYVGVKSIIEYEIHNEGNKKNVSE
DDQSGSSYIPVTISKDSVTKAYRYGADYVVLPSVLVDQTVYESFPGLDLRGFLNREALPR
YFLTSESSFITADTRLGCQSDLMAFSALVDVMLENRKIAVARYVSKKDSEVNMCALCPVL
IEHSNINSEKKFVKSLTLCRLPFAEDERVTDFPKLLDRTTTSGVPLKKETDGHQIDE
Structures of the domain Q04437 236-472
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5y58 X-ray 2.8 F 236-472 None
5y58 X-ray 2.8 D 236-472 None
5y58 X-ray 2.8 B 236-472 None


© NPIDB team 2003 - 2021

text