Pfam domain
Pfam family: Ssl1 (PF04056.16)
Uniprot AC: Q04673
RecName: General transcription and DNA repair factor IIH subunit SSL1
Begin-End: 129-325
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TLDCSEAMLEKDLRPNRHAMIIQYAIDFVHEFFDQNPISQMGIIIMRNGLAQLVSQVSGN
PQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGSLSTTDPGDIH
QTIDSLVSEKIRVKVLGLSAQVAICKELCKATNYGDESFYKILLDETHLKELFNEAVTPL
PVNKINKGFTLVKMGFP
Structures of the domain Q04673 129-325
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 6 129-317 None
5oqm X-ray 5.8 6 129-317 None
6gym X-ray 6.7 6 129-317 None


© NPIDB team 2003 - 2021

text