Pfam domain
Pfam family: C1_4 (PF07975.14)
Uniprot AC: Q04673
RecName: General transcription and DNA repair factor IIH subunit SSL1
Begin-End: 402-456
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DCFSCQSRFPILKNHKNGKLLTSSRYRCEDCKQEFCVDCDVFIHEILHNCPGCES
Structures of the domain Q04673 402-456
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 6 402-456 None
5oqm X-ray 5.8 6 402-456 None
6gym X-ray 6.7 6 402-456 None


© NPIDB team 2003 - 2021

text