Pfam domain
Pfam family: RNA_pol_I_TF (PF04090.14)
Uniprot AC: Q04712
RecName: RNA polymerase I-specific transcription initiation factor RRN11
Begin-End: 173-383
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
MEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLA
YKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRS
IVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEW
VLTPPFMEDAEVWFIYASCHLLKADTLSRQF
Structures of the domain Q04712 173-383
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tps X-ray 3.54 R 173-383  L-Bb 
5w5y X-ray 3.8 Q 173-383  H-Bb L-Bb L-Mj L-Mn 
6ruo X-ray 3.5 R 173-383  H-Bb L-Bb 
6rrd X-ray 3.1 R 173-383  H-Bb L-Bb 
6rql X-ray 2.9 R 173-383  H-Bb L-Bb L-Mj 
5w66 X-ray 3.9 Q 173-383  H-Bb L-Bb 
5w65 X-ray 4.3 Q 173-383  H-Bb L-Bb 
6rqh X-ray 3.7 R 173-383 None
6rwe X-ray 3 R 173-383  H-Bb L-Bb 
6rui X-ray 2.7 R 173-383  H-Bb L-Bb 
5w64 X-ray 4.2 Q 173-383  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text