Pfam domain
Pfam family: Actin (PF00022.21)
Uniprot AC: Q05123
RecName: Actin-like protein ARP9
Begin-End: 18-375
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDIS
AFTQFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEI
NNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDS
LKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENEDEDEGTLNVAEIITSGRD
TREVLEERERGQKVKNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTL
DNIDDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKS
Structures of the domain Q05123 18-375
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 g 19-364 None
6kw3 X-ray 7.13 g 18-288 None
6uxw X-ray 8.96 Q 18-288 None
6kw5 X-ray 10.13 g 18-288 None
6tda X-ray 15 U 18-288 None
6v92 X-ray 20 B 40-288 None
6vz4 X-ray 3.9 M 18-288 None


© NPIDB team 2003 - 2021

text