Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: Q05471
RecName: Helicase SWR1
Begin-End: 699-999
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTSVLL
NWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNKPDAFHVCIVSYQLVVQDQHSFKRKRW
QYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVIDG
KKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLHQVLRPYLLRRLKADVE
KQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPNL
F
Structures of the domain Q05471 699-999
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gej X-ray 3.6 M 699-999 None
6gen X-ray 3.6 M 699-999 None


© NPIDB team 2003 - 2021

text