Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: Q05B79
RecName: ATP-dependent DNA/RNA helicase DHX36
Begin-End: 212-378
Organism: Bos taurus
Interaction Mode:   

Sequence:
YGMQKELVNMIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISA
ISVAERVAAERAESCGNGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDPHLSSVS
HIVLDEIHERNLQSDVLMTVVKDLLSYRPDLKVVLMSATLNAEKFSE
Structures of the domain Q05B79 212-378
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vhe X-ray 3.79 A 212-378 None


© NPIDB team 2003 - 2021

text