Pfam domain
Pfam family: SNF5 (PF04855.14)
Uniprot AC: Q06168
RecName: Chromatin structure-remodeling complex subunit SFH1
Begin-End: 271-383
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TEIMSDLHVIINLTCNLQDRFFEDNFQWNLNDKSLTPERFATSIVQDLGLTREFIPLISQ
SLHETILKIKKDWVDGHLIQDHVPNDAAFGYLSGIRLDIDELGSNWCPRVEIL
Structures of the domain Q06168 271-383
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 G 270-383 None
6kw3 X-ray 7.13 G 143-300 None
6kw5 X-ray 10.13 G 143-300 None
6v92 X-ray 20 Q 270-385 None


© NPIDB team 2003 - 2021

text