Pfam domain
Pfam family: PhdYeFM_antitox (PF02604.21)
Uniprot AC: Q06253
RecName: Antitoxin phd
Begin-End: 1-61
Organism: Escherichia phage P1
Interaction Mode:   

Sequence:
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLF
D
Structures of the domain Q06253 1-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4zm2 X-ray 3.88 B 1-59  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text