Pfam domain
Pfam family: HEAT_2 (PF13646.8)
Uniprot AC: Q06680
RecName: Condensin complex subunit 3
Begin-End: 119-214
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IRHVLRGVESPDKNVRFRVLQLLAVIMDNIGEIDESLFNLLILSLNKRIYDREPTVRIQA
VFCLTKFQDEEQTEHLTELSDNEENFEATRTLVASI
Structures of the domain Q06680 119-214
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqo X-ray 3.25 A 119-231  H-Bb 
5oqp X-ray 2.98 A 119-231  H-Bb 
5oqn X-ray 3.15 A 119-231 None


© NPIDB team 2003 - 2021

text