Pfam domain
Pfam family: Bromodomain (PF00439.27)
Uniprot AC: Q07979
RecName: Chromatin structure-remodeling complex protein RSC58
Begin-End: 29-122
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
HVVDESFPAKFFEKNPDKIYESYCKFIKNRSNSEGLIRNEDKLVLTTINKRFENGEYEPI
QGGFYKLYHDIKLVCTILIHFYPQGTRNYQLVDK
Structures of the domain Q07979 29-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 A 36-121 None
6kw3 X-ray 7.13 A 36-121 None
6kw5 X-ray 10.13 A 36-121 None
6tda X-ray 15 P 73-121 None
6v92 X-ray 20 O 36-121 None


© NPIDB team 2003 - 2021

text