Pfam domain
Pfam family: CDC45 (PF02724.16)
Uniprot AC: Q08032
RecName: Cell division control protein 45
Begin-End: 25-159
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
CQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVPIFGYSELRRHYSQLDDNINSLLLV
GFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDIYVLDAHRPWNLDNIFGSQIIQCFD
DGTVDDTLGEQKEAY
Structures of the domain Q08032 25-159
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u8t X-ray 4.9 E 28-225 None
5u8s X-ray 6.1 E 28-225 None
6u0m X-ray 3.9 E 28-225 None


© NPIDB team 2003 - 2021

text